SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110380 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110380
Domain Number 1 Region: 658-916
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.75e-60
Family Protein kinases, catalytic subunit 0.0000000559
Further Details:      
 
Domain Number 2 Region: 34-223
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-56
Family Ephrin receptor ligand binding domain 0.00000507
Further Details:      
 
Domain Number 3 Region: 363-574
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-32
Family Fibronectin type III 0.0000498
Further Details:      
 
Domain Number 4 Region: 940-1012
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.85e-17
Family SAM (sterile alpha motif) domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000110380
Domain Number - Region: 293-366,402-422
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00251
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110380   Gene: ENSMUSG00000029869   Transcript: ENSMUST00000114732
Sequence length 1014
Comment pep:known chromosome:GRCm38:6:41605482:41620509:1 gene:ENSMUSG00000029869 transcript:ENSMUST00000114732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEGTTGSGSRVVAGMVCSLWLLVLGSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEV
SVLDDQRRLTRTFEACHVAGLPPGSGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGV
SGGTCRETFTLYYRQADEPDGPDSIAAWHLKRWTKVDTIAADESFPASSSSSSWAVGPHR
TGQRVGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYTCPSVLRAFASFPET
QASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGRWMVAVGGCRCQPGH
QPARGDKLCQACPEGSYKALAGNVPCSPCPARSHSPDPAAPVCPCLQGFYRASSDPPEAP
CTGPPSAPRELWFEVQGSALMLHWRLPQELGGRGDLLFNVVCKECGGHGEPSSGGMCRRC
RDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEV
PSAVPVMHQVSRAANSITVSWPQPEQTNGNILDYQLRYYDQAEDESHSFTMTSETNTATV
TRLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPEKLSLVIGSILGALAFL
LLAAITVLAVIFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYDDPCQAIRELAREVDP
TYIKIEEVIGAGSFGEVRRGRLQPRGRREQAVAIQALWAGGAESLKMTFLGRAALLGQFQ
HPNILRLEGVVTKSRPVMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLS
SFAFVHRALSARSVLVNSHLVCKVARLGHSPQGSSSLLRWAAPEVITHGKYTTSSDVWSF
GILMWEVMSYGERPYWDMNEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPH
FDQLVAAFDKMIRKPDTLQAEGGSGDRPSQALLNPVALDFPCLDSPQAWLSAIGLECYQD
NFSKFGLSTFSDVAQLSLEDLPGLGITLAGHQKKLLHNIQLLQQHLRQPGSVEV
Download sequence
Identical sequences O08644
ENSMUSP00000110380 NP_001139823.1.92730 NP_031706.3.92730 ENSMUSP00000110380 ENSMUSP00000031903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]