SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110595 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110595
Domain Number 1 Region: 473-603
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.1e-54
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 122-341
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000312
Further Details:      
 
Domain Number 3 Region: 294-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.02e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110595   Gene: ENSMUSG00000036932   Transcript: ENSMUST00000114945
Sequence length 608
Comment pep:novel chromosome:GRCm38:X:48474944:48513559:-1 gene:ENSMUSG00000036932 transcript:ENSMUST00000114945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPVVQCHLLGSPSRTLASAGASGKDGSS
LVYFLIVGATVTGAGIYYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGGSVPQ
IRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDP
NVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKL
NDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITV
IGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMP
NAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNA
ELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSD
LGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPP
SAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVA
KLFNIHED
Download sequence
Identical sequences B1AU25
NP_001277293.1.92730 ENSMUSP00000110595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]