SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000111481 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000111481
Domain Number 1 Region: 9-184
Classification Level Classification E-value
Superfamily RUN domain-like 2.88e-42
Family RUN domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000111481   Gene: ENSMUSG00000071669   Transcript: ENSMUST00000115814
Sequence length 374
Comment pep:known chromosome:GRCm38:16:11322972:11403836:1 gene:ENSMUSG00000071669 transcript:ENSMUST00000115814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSQNDDRRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGMKRS
RGLALTAAAIKQAAGFTSKTETEPVFWVYVKEVLNKHELQRFYSLHHITSDAGRGRAWLR
CALNEHSLERYLHMLLADRARLSTFYEDWSFVMDEERSSMLPTMAAGLNSILFAINIDNK
DLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGMSSLLREITASSAVSILIKPEQETDPL
PVISKNVHVDTRCKRERRRRKKVTNIVSFDDDEEEQGTGDTLKKMPGTAESSEENSDRSS
VNIMAAFEGTFGPNSNGSQSSSSWKIDSASLNGELGYQKLDVKSIDDDVDENEEDAYRSP
LGRGHTGHAESPDR
Download sequence
Identical sequences D3YZ90
ENSMUSP00000111481 ENSMUSP00000111481 ENSMUSP00000111481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]