SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112134 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112134
Domain Number 1 Region: 44-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.52e-39
Family SCAN domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 209-251
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000301
Family KRAB domain (Kruppel-associated box) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112134   Gene: ENSMUSG00000021327   Transcript: ENSMUST00000116433
Sequence length 298
Comment pep:novel chromosome:GRCm38:13:21393232:21402716:-1 gene:ENSMUSG00000021327 transcript:ENSMUST00000116433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARESRESTTLDSHSAEDQMELLVIKVEQEEASPLAEETSWLGSPGPDRSRQRFRAFRYP
EAAGPRQALSRLRELCRQWLRPDMHSKEQILELLVLEQFLTILPGELQAWVREQHPDSGE
EVVALLEYLDRQLDDTPPQVPDDDDGQELLCSKAVLLTSAQGSESSQMEPVEPLLKQESL
GSLPSEVRVTHVGHCGEDGVTATRLTSELQGLLKMEDVAPVLSPRWTEQDSSQMNLYKDG
MQEHSGSLVSLVRVSIAMTKHYNQKQLGEERIYFNLQFHTIVYHQRKSRQELKAGAWR
Download sequence
Identical sequences Q5RJ53
ENSMUSP00000112134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]