SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112221 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112221
Domain Number 1 Region: 264-364
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-27
Family SH2 domain 0.00034
Further Details:      
 
Domain Number 2 Region: 188-290
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-22
Family SH3-domain 0.0000774
Further Details:      
 
Domain Number 3 Region: 111-168
Classification Level Classification E-value
Superfamily SH3-domain 1.12e-21
Family SH3-domain 0.00067
Further Details:      
 
Domain Number 4 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112221   Gene: ENSMUSG00000032475   Transcript: ENSMUST00000116522
Sequence length 377
Comment pep:known chromosome:GRCm38:9:100492293:100546134:-1 gene:ENSMUSG00000032475 transcript:ENSMUST00000116522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
Download sequence
Identical sequences Q99M51
ENSMUSP00000112221 NP_035008.2.92730 XP_003502557.1.69978 XP_006510903.1.92730 XP_006975194.1.50099 XP_007632213.1.28591 XP_015849530.1.50099 XP_015849531.1.50099 XP_015849533.1.50099 XP_016827770.1.28591 XP_016831128.1.69978 ENSMUSP00000112221 10090.ENSMUSP00000112221 ENSMUSP00000108495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]