SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112907 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112907
Domain Number 1 Region: 95-229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000033
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 238-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 272-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000264
Family EGF-type module 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000112907
Domain Number - Region: 395-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00694
Family EGF-type module 0.082
Further Details:      
 
Domain Number - Region: 480-526
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.011
Family Growth factor receptor domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112907   Gene: ENSMUSG00000063600   Transcript: ENSMUST00000118531
Sequence length 533
Comment pep:novel chromosome:GRCm38:3:29082771:29690510:1 gene:ENSMUSG00000063600 transcript:ENSMUST00000118531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPLCFWCFCVWAAANWPPGSALQLQPGMPNVCREEQLTLVRLSRPCAQAFIDTIQFWK
QGCSGPRWCVGYERRIRYYIIYRHVYATEHQTVFRCCPGWIQWDDEPGCFSSLSSLGTHF
SGRECSYQDTRQCLCSQGFHGPHCQYDINECAVDNGGCRDRCCNTIGSYYCRCQAGQKLE
EDGRGCEDVDECAVVNGGCQQRCINTLGTFHCECDTGYRRHADERTCIRIELEIVNICEK
NNGGCSHHCEPAIGGAHCSCNHGHQLDTDGKTCIDFDECESGEACCAQLCINYLGGYECS
CEEGFQISSDGCGCDALDEQLEEEEEEIDILRFPGRLAQNPPQPFPYLDPSLTASYEDED
NDDADSEAEGEVQGLTALYRVVCLDGTFGLDCSLSCEDCMNGGRCQEGKSGCLCPAEWTG
LICNESSVLRTGEDQQAPAGCLKGFFGKNCKRKCHCANNVHCHRVYGACMCDLGRYGRFC
HLSCPRGAYGASCSLECQCVEENTLECSAKNGSCTCKSGYQGNRCQEELPLPA
Download sequence
Identical sequences NP_001161220.1.92730 ENSMUSP00000112907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]