SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112934 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112934
Domain Number 1 Region: 1015-1105
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 836-938
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-24
Family PDZ domain 0.00014
Further Details:      
 
Domain Number 3 Region: 399-503
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-23
Family PDZ domain 0.0000635
Further Details:      
 
Domain Number 4 Region: 701-813
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-17
Family PDZ domain 0.00025
Further Details:      
 
Domain Number 6 Region: 125-196
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 292-329
Classification Level Classification E-value
Superfamily WW domain 0.000000000000371
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 340-374
Classification Level Classification E-value
Superfamily WW domain 0.00000000127
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 17-113
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000631
Family PDZ domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112934   Gene: ENSMUSG00000052539   Transcript: ENSMUST00000121198
Sequence length 1476
Comment pep:putative chromosome:GRCm38:3:104013625:104220103:-1 gene:ENSMUSG00000052539 transcript:ENSMUST00000121198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEAGGGGGTCC
VVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLS
LQFQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALL
ESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPE
EEEDEDKEAVNGSGSMETREMHSETSDCWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPK
NWEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYY
VDHLNQKTQFENPVEEAKRKKQLGQAEIHSAKTDVERAHFTRDPSQLKGVLVRASLKKST
MGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMF
QLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNTQDFKLGAMV
LDQNGKSGQILASDRLNGPSESSEQRASLASSGSSQPELVTIPLIKGPKGFGFAIADSPT
GQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGP
CSPTKTAKTKTDTKENSGSLETINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYED
KPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCID
GIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDESHQAFSQNGSPRLNRAE
LPTRSAPQEAYDVTLQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIDGSPADRCGGLKV
GDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPALQHR
PMGQAQANHIPGDRIALEGEIGRDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHNQSLGC
YPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGI
THTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDTNSPSSSNVIYDEQPPPLPSSHSAST
FEESHVPATEDSLTRVQICEKAEELKDTVQEKKSTLNGSQPEMKYQSVHKTMSKKDPPRG
SGHGEKSRLKGENGVTRRGRSASPKKSVNRHSEEHLEKIPRPLKSDPKEKSRDRSLSPRK
GESKGRLTIKAGSGQDPNRKDRGRSSSPKKQQKIGGNSLSNTEGKLSEAGSRRAAGHPRD
STEQLPDGREKSGVSRKDLKQSQPGKTRTKSPEKKSSKVDETSLPSKKTSSTAGRVVSEK
EKGKKPTAGETSRETVEHTQISAKQLKQEAQEKTALGNADDHKGRESEVTDRCRERAGCT
PQSSSLVKKAPITPGPWRVPRANKVTGTTGMADKQL
Download sequence
Identical sequences G5E8T6
ENSMUSP00000112934 NP_001152826.1.92730 ENSMUSP00000112934 ENSMUSP00000112934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]