SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112999 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112999
Domain Number 1 Region: 903-1098
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.28e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000324
Further Details:      
 
Domain Number 2 Region: 691-824
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-26
Family Pleckstrin-homology domain (PH domain) 0.0000311
Further Details:      
 
Domain Number 3 Region: 19-58,88-161
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112999   Gene: ENSMUSG00000049807   Transcript: ENSMUST00000121799
Sequence length 1488
Comment pep:known chromosome:GRCm38:11:97415533:97502402:1 gene:ENSMUSG00000049807 transcript:ENSMUST00000121799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVAFCLVGIPPRPEPRPPQLPLGPRDGCSSGRPLPWPGPRTLLLRKSLQDGFGFTLRH
FIVYPPESAVHCILKEEENGGRGGRGGGGGPSPRHRLEPMDTIFVKNVKDGGPAHRAGLR
TGDRLVKVNGESIIGKTYSQVIGLIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPY
SGEARSIPEPPPLCYPRKTYAPPTRAPAWATMVPEPISALPPDPRSPAAWSDPGSRVPSA
TRAHLDNSSLGMSQPRPSPGAFPHLPSESRTPRAFPEPGSRVLPSRLECQQALSHWLSNQ
IPRRAGERRCPAMPPRARSASQDRLEDVTTHHPWPCSTSQDALSQLGQEGWHRARSDDYL
SRATRSAEALGPGALVSPRLERCGWASQRPSARTSACPSRDLTQAPPPSGLQGLDDIGYI
GYRSYSPSFQRRTGLLHALSFRDSPFGGLPTFSLAQSPASFPPEASEPPRVVRPDPSTRA
LEPPAEDHRDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEARGERLGRKVAPLATT
EDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFALSRHYSQ
DCSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRVLRRLPSRVPSLRVLRSFFTDGS
LDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQILTKKGKKAGGGLRQWKRVY
AVLRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLT
TADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSGPK
ADSSPKGSRGLGGLKSEFLKQTAVRGLRTQEQPPGSKEDSVAAPKTPWGINIIKKNKKAA
PRAFGIRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNR
GPSDINLQDERWQDLNVISSLLKAFFRKLPEPLFTDDKYNDFIEANRIEDSRERMKTLRK
LIRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHM
PDRYKIVETLIQHSDWFFSDDEDKGERTPVDDKEPQSVPNIEYLLPNIGRTVPPSDPGSD
STTCSSAKSKGSWVPKKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHK
AAVGTQEPPEGQLPGPAAEEAPGRLSPPTAPDERPAADTRSIVSGYSTLSTMDRSVCSGT
GGRRAGAGDEADDERSELSHVETDTEGGAGPGGRLSRRPSFSSHHLMPCDTLARRRLSRS
RAEAEGPGAGTARACPRGPEPPGSASSSSQESLRPPAAAPALGSRPSRVEALRLRLRGTA
DDMLAVRLRRPLSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPQESVGVRPHS
DNKDSGLSSLESTKARASSAASLPSGDLGALQGLPQRRSAAARLHQCL
Download sequence
Identical sequences B1AQY2
ENSMUSP00000091472 XP_006533929.1.92730 10090.ENSMUSP00000112999 ENSMUSP00000112999 ENSMUSP00000112999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]