SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113191 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113191
Domain Number 1 Region: 210-292
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.52e-28
Family PHD domain 0.001
Further Details:      
 
Domain Number 2 Region: 337-594
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.67e-26
Family Hect, E3 ligase catalytic domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000113191
Domain Number - Region: 139-198
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000736
Family PHD domain 0.024
Further Details:      
 
Domain Number - Region: 68-106
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.032
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113191   Gene: ENSMUSG00000035293   Transcript: ENSMUST00000121521
Sequence length 622
Comment pep:novel chromosome:GRCm38:12:51348372:51373370:1 gene:ENSMUSG00000035293 transcript:ENSMUST00000121521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNENKPDNSQSLACVFCRKNDDCPNKYGEKKTYEKWNFSVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVQRASKLKCTVCKKNGASIGCVVPTCKRSYHLPCGLQKECIFQFTDNF
ASFCWKHRPVQAITSNKYSSSLPCTICLEFVEPIPTYNILQSPCCKNAWFHRDCLQVQAI
NAGVFFFRCTLCNNTDIFQKEMLRMGIHIPEKDASWELEENAYQELLQSHDRCDIRRCHC
KKGRDYNEPNSKWEVKRCQSCGSSGTHLACSSLQSWEQNWECLDCRRITYTSDFQKAPKH
PLANSTNVTVTDCLLEESSSKLPRQSTVAQHKELLSLFLSVFTAVKENLYYEVGKMLAIS
LVHGGPSPGFFSETLFNCLAYGPENTLPTLDDVSDIDVAQIIIKIDSATDLNILNSVISQ
HYNYLEVSGCLRLTTSLSDKFMLVKDILFYHVINRVKAPFESFKQGLKTLGVLEKIQTYP
EAFYKILCHKPENLSAKNLSDLFTIHSVADVQTLRFWNSYLKAIEDGKSATTMEDILIFA
TGCSSVPPTGFKPSLSVECLHVDFPVADKYRNHLVLPATNTYEEFQENMDFTIRDTLRLE
KEERSHILPRTLNVSSNEEMLI
Download sequence
Identical sequences E9Q7E5
NP_001161436.1.92730 ENSMUSP00000113191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]