SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113429 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113429
Domain Number 1 Region: 9-173
Classification Level Classification E-value
Superfamily RUN domain-like 7.59e-49
Family RUN domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 536-602
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.65e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000113429
Domain Number - Region: 367-533
Classification Level Classification E-value
Superfamily Tropomyosin 0.0294
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113429   Gene: ENSMUSG00000020070   Transcript: ENSMUST00000119567
Sequence length 606
Comment pep:known chromosome:GRCm38:10:62980242:63013955:1 gene:ENSMUSG00000020070 transcript:ENSMUST00000119567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKG
RKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLKTPLGRARAWLRLALMQKKMAD
YLRCLIIQRELLSEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDF
SMYLKNEEEIGNKERNVQIAAILDQKNYVEELNRQLNSTVSSLHSRVDSLEKSNTKLIEE
LAIAKNNIIKLQEENHQLRSENELILMRTRQHLEVTKVDVETELQTYKHSRQGLDEMYND
ARRQLRDESQLRQDVENELSVQVGMKHEMELAMKLLEKDIHEKQDTLIGLRQQLEEVKAI
NIEMYQRLQGSEDGLKEKNEIIARLEEKTNKITTAMRQLEQRLQQAEKAQKEAEAEDEKY
AQECLSQSDSLQRQISQKEQQLVQLETDLKIEKEWRQTLQEDLQKEKDVLSHLRHETQKV
ISLKKEFLNLQDENQQLKRIYQEQEQALQELGSKLCESKLKIDDIKEANKALQGLVWLKD
KDATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSCHAMLIQR
CSSNMP
Download sequence
Identical sequences B2RQ36 Q8R4C2
NYSGXRC-13127a ENSMUSP00000113429 ENSMUSP00000113429 NP_081701.2.92730 ENSMUSP00000113429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]