SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114932 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114932
Domain Number 1 Region: 8-199
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-35
Family RUN domain 0.00062
Further Details:      
 
Domain Number 2 Region: 593-661
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000314
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114932   Gene: ENSMUSG00000042216   Transcript: ENSMUST00000154248
Sequence length 706
Comment pep:novel chromosome:GRCm38:5:113266287:113310697:-1 gene:ENSMUSG00000042216 transcript:ENSMUST00000154248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVPAEAETRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRR
AAGFLRSNKIAALFMKVGKGFPPAEELSRKVQELEQLIESARNQIQGLQENVRKLPKLPN
LSPLAIKHLWIRTALFERVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCAL
EYTKMKTADHFWTDPSADELVQRHRIHSSHLRQDSPTKRPALCIQKRHSSGSMDDRPSIS
ARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGS
VGDLDYEKSVYWDYAVTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLL
QFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESTSSDKEDDEATDYVFR
IIYPGTQSEFVALDLMGSPRPVSIGPAWMMLAAGQSMLVVAKGLQWAQTRGCLTIPTRSV
KEQPPMPQDLMDVSMNNLPPLWQPSPRKSSCSSCSQSGSADGGSTNGCNHERAPLKLLCD
NMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAGQGLTASIWEKYIQD
STTYPEQELLRLIYYGGVQPEIRRAVWPFLLGHYQFGMTEMERKEVDEQIHACYAQTMSE
WLGCEAIVRQRERESHAAALAKCSSGASLDSHLHRMLHRDSTISNE
Download sequence
Identical sequences D3YUT7
ENSMUSP00000114932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]