SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114956 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114956
Domain Number 1 Region: 24-56
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000923
Family FAD-linked reductases, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114956   Gene: ENSMUSG00000027333   Transcript: ENSMUST00000131698
Sequence length 56
Comment pep:novel chromosome:GRCm38:2:131492264:131512177:1 gene:ENSMUSG00000027333 transcript:ENSMUST00000131698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEA
Download sequence
Identical sequences A2AP08
ENSMUSP00000114956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]