SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115013 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115013
Domain Number 1 Region: 2-210
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.77e-48
Family FCH domain 0.000000047
Further Details:      
 
Domain Number 2 Region: 304-374
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000114
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115013   Gene: ENSMUSG00000075415   Transcript: ENSMUST00000128500
Sequence length 388
Comment pep:known chromosome:GRCm38:2:31033009:31105352:-1 gene:ENSMUSG00000075415 transcript:ENSMUST00000128500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTA
CKAFLSTLNEMNDYAGQHEVISENMTSQITVDLMRYVQELKQERKSNFHDGRKAQQHIET
CWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKGVTPEDFSNFPPEQRRKK
LQQKVDDLNREIQKETDQRDAITKMKDVYLKNPQMGDPASLDQKLTEVTQNIEKLRLEAQ
KFEAWLAEVEGRLPARSEQARRQSGLYDGQTHQTVTNCAQDRESPDGSYTEEQSQESEHK
VLAPDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLSVIEEDKGDGWTRIRR
NEDEEGYVPTSYVEVYLDKNAKGAKTYI
Download sequence
Identical sequences F6VVN1
ENSMUSP00000115013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]