SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115455 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115455
Domain Number 1 Region: 240-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Integrin beta EGF-like domains 0.021
Further Details:      
 
Domain Number 2 Region: 327-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 3 Region: 16-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number 4 Region: 161-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family Integrin beta EGF-like domains 0.054
Further Details:      
 
Domain Number 5 Region: 289-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 6 Region: 200-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000115455
Domain Number - Region: 63-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115455   Gene: ENSMUSG00000032925   Transcript: ENSMUST00000132026
Sequence length 370
Comment pep:novel chromosome:GRCm38:14:123661424:123975618:1 gene:ENSMUSG00000032925 transcript:ENSMUST00000132026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTEPGTYFGPLCECHEWICETYDGKTCAGHGNCDCGKCKCDVGWSGEACQYPTKCDLTKK
ISNQMCKNSQDVICSNAGTCHCGRCKCDNSDGHGLIYGKFCECDDRECIDDETEEVCGGT
CVCGECSCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCRAG
WYGKKCEHPRNCPLSAEESTKKCQGSSDLPCSGRGRCECGRCTCYPPGDSRVYGKTCECD
DRRCEDLDGVVCGGHGMCSCGRCVCEKGWFGKLCQHLRKCNMTEEQSRSLCESADGTLCS
GKGSCHCGKCICSGEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNA
CEIWLGTEYP
Download sequence
Identical sequences B1B1E3
ENSMUSP00000115455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]