SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000116869 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000116869
Domain Number 1 Region: 5-169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-30
Family MAM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 224-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 180-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 264-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000484
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000116869   Gene: ENSMUSG00000075520   Transcript: ENSMUST00000146205
Sequence length 321
Comment pep:putative chromosome:GRCm38:2:16042126:16150806:1 gene:ENSMUSG00000075520 transcript:ENSMUST00000146205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTSTAGSCNFETTSGDWTVECGLTQDPEDDLDWSIGSIIPTEGLSRDSDHTPGSGRHFLY
VNTSLAEEGSTARIITSHFFPASLGICTVRFWFYMVDPHIVGILKVYLIEKSGLNILMWS
MMRNKNTGWTYAHVPLSSNSPFKVAFEADLGGKEDIFIALDDITFTPTCASGGPALPQPP
LCEEGQFACIYALQCVSASEKCDGQEDCIDGSDEMNCSLGPSPQPCSDTEFQCFESQCIP
SLLLCDGVADCQFNEDESSCVNQSCPSGALACNSSGLCIPAHQRCDGTAHCKDIQVDESS
CSECPIHYCRNGGTCVIENIG
Download sequence
Identical sequences ENSMUSP00000116869 ENSMUSP00000116869 ENSMUSP00000116869 10090.ENSMUSP00000097957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]