SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117147 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117147
Domain Number 1 Region: 64-169
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000228
Family FAD-linked reductases, N-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117147   Gene: ENSMUSG00000039048   Transcript: ENSMUST00000142595
Sequence length 205
Comment pep:putative chromosome:GRCm38:9:35206223:35210996:-1 gene:ENSMUSG00000039048 transcript:ENSMUST00000142595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRALRLGLGPGLPYRGLRTRKGGFTLDWDAKVSDFKKKVDSILPGKKYEVLYDTSHLP
PEQADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQF
SVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQR
FHHFIYPNEDPNWGTCSLEKDQQCP
Download sequence
Identical sequences D3Z5V7
ENSMUSP00000117147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]