SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000117464 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000117464
Domain Number 1 Region: 10-170
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-53
Family Carbonic anhydrase 0.0000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000117464   Gene: ENSMUSG00000038526   Transcript: ENSMUST00000147962
Sequence length 171
Comment pep:putative chromosome:GRCm38:3:95899740:95904685:-1 gene:ENSMUSG00000038526 transcript:ENSMUST00000147962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLHCSETTGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEP
LDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHV
VHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYK
Download sequence
Identical sequences D3Z4J8
ENSMUSP00000117464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]