SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Mus musculus 76_38 > ENSMUSP00000118020

Domain assignment for ENSMUSP00000118020 from Mus musculus 76_38

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMUSP00000118020
Domain Number 1	Region: 289-549
Classification Level	Classification	E-value
Superfamily	YWTD domain	8.63e-55
Family	YWTD domain	0.0000000202
Further Details:

Domain Number 2	Region: 39-76
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000157
Family	LDL receptor-like module	0.0008
Further Details:

Domain Number 3	Region: 161-198
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000017
Family	LDL receptor-like module	0.00098
Further Details:

Domain Number 4	Region: 78-116
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000641
Family	LDL receptor-like module	0.00079
Further Details:

Domain Number 5	Region: 205-250
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000324
Family	EGF-type module	0.0023
Further Details:

Domain Number 6	Region: 241-280
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000437
Family	EGF-type module	0.0014
Further Details:

Domain Number 7	Region: 115-158
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000484
Family	LDL receptor-like module	0.00069
Further Details:

Domain Number 8	Region: 559-600
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000167
Family	EGF-type module	0.0016
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMUSP00000118020 Gene: ENSMUSG00000028613 Transcript: ENSMUST00000126573
Sequence length	694
Comment	pep:novel chromosome:GRCm38:4:107802413:107872816:1 gene:ENSMUSG00000028613 transcript:ENSMUST00000126573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGRPELGALRPLALLLLLLLQLQHLSAADPLPGGQGPVKECEEDQFRCRNERCIPLVWRC DEDNDCSDNSDEDDCPKRTCADSDFTCDNGHCIPERWKCDGEEECPDGSDESKATCSSEE CPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTSPGPCRENEFQCGDGTCVLAI KRCNQERDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCG DIDECQDPDACSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGKSPSLIFTNRHEVRRI DLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQ LHSPEGLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMY WSDWGFQAKIEKAGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNG GNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDI VIFHELKQPKAADACDLSAQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCY RDGNEGSQMGSTVTAAVIGVIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTT EEEEEDELHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences	B1AXJ6 ENSMUSP00000118020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]