SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118123 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118123
Domain Number 1 Region: 715-942
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-59
Family DBL homology domain (DH-domain) 0.00000000108
Further Details:      
 
Domain Number 2 Region: 310-486
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.05e-54
Family Regulator of G-protein signaling, RGS 0.0000000445
Further Details:      
 
Domain Number 3 Region: 946-1080
Classification Level Classification E-value
Superfamily PH domain-like 4.01e-41
Family Pleckstrin-homology domain (PH domain) 0.00000036
Further Details:      
 
Domain Number 4 Region: 25-121
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000118123
Domain Number - Region: 149-160
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118123   Gene: ENSMUSG00000041977   Transcript: ENSMUST00000129113
Sequence length 1476
Comment pep:novel chromosome:GRCm38:3:87617585:87735909:1 gene:ENSMUSG00000041977 transcript:ENSMUST00000129113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRLPHSIDRLSSLSSLGDSTPERTSPSHHRQPSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSIGVSGLQQNPSLSGGPRVNPMIPPPPPPPPLPPPQHITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQDVLPLCGETSQRTCEGRLSVDSQEADSGLDSGTERFPSISESLVNR
NSVLSDPGLDSPQTSPVILARVGQHHRRQGSDAAVHPLNHQGIDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSHPAYLVVFLRYIFSQADPGPLLFYLCSEVYQQTNPKDSRNL
GKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNSEDPRSALYEAQEAVMPEIQEQINDYR
SKRTLGLGSLYGENDLLDLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTYM
SHTGIRLRESRPSSTAEKTQSAPDKDKWLPFFPKTKKQSSNSKKEKDALEDKKRNPILRY
IGKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENSHQYDVPEPGTQRLSTGSFPEDLLE
SDSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSL
STRSLENPTPPFTPKMGRRSIESPNLGFCTDVILPHLLEDDLGQLSDLEPEPEVQNWQHT
VGKDVVANLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELSRLF
PNLPELIEIHNSWCEAMKKLREEGPIIRDISDLMLARFDGPAREELQQVAAQFCSYQSVA
LELIRTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLENIIKHTAGG
TSEYEKLCRARDQCREILKFVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSL
DLTTRKMIHEGPLTWRISKDKTLDLQVLLLEDLVVLLQRQEEKLLLKCHSKTAVGSSDSK
QTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVALTSSDKNIWMELLEEAVQ
NATKHPGDAPVLNHPSPPGSQEPAYQGSTSSRVEVNDSEVYPTEREPKKPSEGPGPEQRG
QDKQLLAQEGPEQEEDAEELRALPCPPPSLDGENRGIRTRDPVLLALTGPLLMEGLADAA
LEDVENLRHLILWSLLPGHTVKTQAAGEPEDDLTPTPSVVSITSHPWDPGSPGQAPAISD
NTQFPRPEGSQPEGEDVALCSLAHLPPRTRNSGIWDSPELDRNPAEEASSSEPAGSYKVV
RKVSLLPGGGVGAAKVAGSNVTPALPESGQSESELSEVEGGAQATGNCFYVSMPAEPLDS
STEPPGTPPSLSQCHSLPAWPTEPPQHRGVTGGQRSSLVLRDMGVIFHTIEQLTVKLHRL
KDMELAHRELLNSLGGESSGGTTPVGSFHTEAARWT
Download sequence
Identical sequences ENSMUSP00000118123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]