SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118745 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118745
Domain Number 1 Region: 822-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000335
Family Laminin-type module 0.00061
Further Details:      
 
Domain Number 2 Region: 280-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000173
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 928-978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 878-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family Laminin-type module 0.00098
Further Details:      
 
Domain Number 5 Region: 336-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 6 Region: 439-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 7 Region: 392-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 719-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 767-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family Laminin-type module 0.00053
Further Details:      
 
Domain Number 10 Region: 976-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000118745
Domain Number - Region: 90-169
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00187
Family CBM4/9 0.078
Further Details:      
 
Domain Number - Region: 680-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118745   Gene: ENSMUSG00000026840   Transcript: ENSMUST00000138325
Sequence length 1537
Comment pep:known chromosome:GRCm38:2:31887291:31945246:1 gene:ENSMUSG00000026840 transcript:ENSMUST00000138325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSRVLSLLATVASMALVIQETHFAAGADMGSCYDGVGRAQRCLPEFENAAFGRRAEAS
HTCGRPPEDFCPHVGAPGAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTY
GRPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDILISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACR
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCDNSGVCPCKPTVTGWK
CDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQP
HNPVGCSSCFCYGHSKVCSPAAGFQEHHIRSDFRHGAGGWQIRSMGVSKRPLQWSQSGLL
LGLRGGEELSAPKKFLGDQRLSYGQPVILTLQVPPGGSPPPIQLRLEGAGLALSLRPSSL
PSPQDTRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVL
LCEVQLTSAWPQRELAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYANCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPGQSACATIPE
SGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHS
GHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVC
LPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASSQCHENSTCVCRPGFVGYKCDRCQDNFFLADGDTG
CQECPTCYALVKEEAAKLKARLMLMEGWLQRSDCGSPWGPLDILQGEAPLGDVYQGHHLL
QETRGTFLQQMVGLEDSVKATWEQLQVLRGHVHCAQAGAQKTCIQLAELEETLQSSEEEV
LRAASALSFLDEPQLFSLLLKASLQKGSSTPTNWSHLASEAQILARSHRDTATKIEATSE
RALLASNASYELLKLMEGRVASEAQQELEDRYQEVQAAQTALGIAVAEALPKAEKALATV
KQVIGDAAPHLGLLVTPEAMNFQARGLSWKVKALEQKLEQKEPEVGQSVGALQVEAGRAL
EKMEPFMQLRNKTTAAFTRASSAVQAAKVTVIGAETLLADLEGMKLRSPLPKEQAALKKK
AGSIRTRLLEDTKRKTKQAERMLGNAASLSSSTKKKSKEAELMSKDNAKLSRALLREGKQ
GYRHASRLASQTQATLRRASRLLLTSEAHKQELEEAKQVTSGLSTVERQIRESRISLEKD
TKVLSELLVKLGSLGVHQAPAQTLNETQRALESLRLQ
Download sequence
Identical sequences A2ATM9
ENSMUSP00000118745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]