SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118801 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118801
Domain Number 1 Region: 489-781
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.43e-65
Family Protein kinases, catalytic subunit 0.0000000514
Further Details:      
 
Domain Number 2 Region: 192-407
Classification Level Classification E-value
Superfamily Fibronectin type III 7.63e-27
Family Fibronectin type III 0.00029
Further Details:      
 
Domain Number 3 Region: 3-64
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-22
Family Ephrin receptor ligand binding domain 0.00036
Further Details:      
 
Domain Number 4 Region: 786-857
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.61e-16
Family SAM (sterile alpha motif) domain 0.00075
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000118801
Domain Number - Region: 121-189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000785
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118801   Gene: ENSMUSG00000028876   Transcript: ENSMUST00000149146
Sequence length 862
Comment pep:putative chromosome:GRCm38:4:124885799:124917800:1 gene:ENSMUSG00000028876 transcript:ENSMUST00000149146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRQGFHLAFQDVGACVALVSVR
VYYKQCRATVRGLAAFPATAAESAFSTLVEVAGTCVAHSEGEPSSPPRMHCGADGEWLVP
VGRCSCSAGFQEHGDICEACPPGFYKVSPRRPLCSPCPEHSLALENASTFCVCQDTYARS
PTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGRDGP
AGACQPCGPRVAFVPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGATYAQV
TVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPVPAGAPGTNSTEYEIRYYEKGQSEQTYS
TVKTGAPAVTVTNLKPATRYVFQIRAASPGPLWEAQSFSPSIEVQTPGEVAPGSRDQSPA
VVVTVVTISALLVLGSVMSVLAIWRRPCDGKGSGNAHDEEELYFHFKVPTRRTFLDPQSC
GDPLQAVHLFAKELDAKSVTLEKSLGAGRFGDLCCGCLQLPGRQELPVAVHTLRDGCSDS
QRLSFLAEALTLGQFDHSHIVRLEGVVTRGNPLMIVTEYMNLGALDDFLRHHEGELVAAQ
LMGLLPGLASAMKYLSEMGYVHRGLAARRVLVSSGLLCKISGFGRGPRDRAEAVYTTMSG
RSPALWAAPETLQFGHFSSASDVWSFGIVMWEVMAFGERPYWDMSGQDVIKAVEDGFRLP
PPRNCPSQLHRLMLECWQKDPSERPRFSQIHSILSKMGQEPEPSKCASTTCLRPPTPLAD
RAFSTFPSFGSVGAWLEALDLCRYKDNFSAAGYGSLEAVAEMTAQDLGSLGISSAEHREA
LLSGISALQTRVLQLQGQGVQV
Download sequence
Identical sequences F6WVB0
ENSMUSP00000118801 ENSMUSP00000118801 ENSMUSP00000118801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]