SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118992 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118992
Domain Number 1 Region: 76-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-17
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118992   Gene: ENSMUSG00000062609   Transcript: ENSMUST00000134166
Sequence length 173
Comment pep:novel chromosome:GRCm38:16:95257659:95296039:1 gene:ENSMUSG00000062609 transcript:ENSMUST00000134166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVARWEKGSEDAPLTLQKIPDLQSGPKMDAIHLGMSSAPLVKHTNGVGLKAHRPRVMSKS
GHSNVRIDKVDGIYLLYLQDLWTTVIDMKWRYKLTLFAATFVMTWFLFGVVYYAIAFIHG
DLQLGESNSNHTPCIMKVDSLTGAFLFSLESQTTIGYGVRSITEECPHAIFLL
Download sequence
Identical sequences D3YXQ3
ENSMUSP00000118992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]