SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119866 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119866
Domain Number 1 Region: 68-196
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-21
Family FAD-linked reductases, N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119866   Gene: ENSMUSG00000009614   Transcript: ENSMUST00000139312
Sequence length 197
Comment pep:known chromosome:GRCm38:2:27241487:27248337:-1 gene:ENSMUSG00000009614 transcript:ENSMUST00000139312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRVLRVAATCPRGRAAWNLGLQPLATEARPTTEKSVPYQRTLKEEAQGASVVPQGP
SQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTSGTTWHTAGLLWQLRPS
DVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRLNEYKRLMSLGKAYGIES
HVLSPAETKSLYPLMNV
Download sequence
Identical sequences A2AH52
ENSMUSP00000119866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]