SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000120391 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000120391
Domain Number 1 Region: 400-614
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-28
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 2 Region: 626-827
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-25
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 3 Region: 849-1049
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.13e-24
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 1235-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000474
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 5 Region: 147-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000482
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 6 Region: 223-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000111
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 7 Region: 1079-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000822
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 185-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 9 Region: 261-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 10 Region: 71-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.017
Further Details:      
 
Domain Number 11 Region: 110-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000093
Family EGF-type module 0.018
Further Details:      
 
Domain Number 12 Region: 1202-1240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 332-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000317
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 1115-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000477
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 15 Region: 1149-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family EGF-type module 0.033
Further Details:      
 
Domain Number 16 Region: 302-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000031
Family EGF-type module 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000120391
Domain Number - Region: 823-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0102
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 863-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0574
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000120391   Gene: ENSMUSG00000063681   Transcript: ENSMUST00000131586
Sequence length 1314
Comment pep:putative chromosome:GRCm38:1:139229538:139377100:-1 gene:ENSMUSG00000063681 transcript:ENSMUST00000131586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKRTAYLLFLYLSSSLLICIKNSFCNKNNTRCLSGPCQNNSTCKHFPQDNNCCLDTAN
NLDKDCEDLKDPCFSSPCQGIATCVKIPGEGNFLCQCPPGYSGLNCETATNSCGGNLCQH
GGTCRKDPEHPVCICPPGYAGRFCETDHNECASSPCHNGAMCQDGINGYSCFCVPGYQGR
HCDLEVDECVSDPCKNEAVCLNEIGRYTCVCPQEFSGVNCELEIDECRSQPCLHGATCQD
APGGYSCDCAPGFLGEHCELSVNECESQPCLHGGLCVDGRNSYHCDCTGSGFTGMHCESL
IPLCWSKPCHNDATCEDTVDSYICHCRPGIHCEEDVDECLLHPCLNGGTCENLPGNYACH
CPFDDTSRTFYGGENCSEILLGCTHHQCLNNGKCIPHFQNGQHGFTCQCLSGYAGPLCET
VTTLSFGSNGFLWVTSGSHTGIGPECNISLRFHTVQPNALLLIRGNKDVSMKLELLNGCV
HLSIEVWNQLKVLLSISHNTSDGEWHFVEVTIAETLTLALVGGSCKEKCTTKSSVPVENH
QSICALQDSFLGGLPMGTANNSVSVLNIYNVPSTPSFVGCLQDIRFDLNHITLENVSSGL
SSNVKAGCLGKDWCESQPCQNRGRCINLWQGYQCECDRPYTGSNCLKEYVAGRFGQDDST
GYAAFSVNDNYGQNFSLSMFVRTRQPLGLLLALENSTYQYVSVWLEHGSLALQTPGSPKF
MVNFFLSDGNVHLISLRIKPNEIELYQSSQNLGFISVPTWTIRRGDVIFIGGLPDREKTE
VYGGFFKGCVQDVRLNSQTLEFFPNSTNNAYDDPILVNVTQGCPGDNTCKSNPCHNGGVC
HSLWDDFSCSCPTNTAGRACEQVQWCQLSPCPPTAECQLLPQGFECIANAVFSGLSREIL
FRSNGNITRELTNITFAFRTHDTNVMILHAEKEPEFLNISIQDARLFFQLRSGNSFYTLH
LMGSQLVNDGTWHQVTFSMIDPVAQTSRWQMEVNDQTPFVISEVATGSLNFLKDNTDIYV
GDQSVDNPKGLQGCLSTIEIGGIYLSYFENLHGFPGKPQEEQFLKVSTNMVLTGCLPSNA
CHSSPCLHGGNCEDSYSSYRCACLSGWSGTHCEINIDECFSSPCIHGNCSDGVAAYHCRC
EPGYTGVNCEVDVDNCKSHQCANGATCVPEAHGYSCLCFGNFTGRFCRHSRLPSTVCGNE
KRNFTCYNGGSCSMFQEDWQCMCWPGFTGEWCEEDINECASDPCINGGLCRDLVNRFLCI
CDVAFAGERCELDVSGLSFYVSLLLWQNLFQLLSYLVLRMNDEPVVEWGAQENY
Download sequence
Identical sequences A0A0G2JDY0
ENSMUSP00000120391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]