SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121331 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121331
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily DEATH domain 1.37e-28
Family Caspase recruitment domain, CARD 0.0000369
Further Details:      
 
Domain Number 2 Region: 182-213
Classification Level Classification E-value
Superfamily Caspase-like 0.0000359
Family Caspase catalytic domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121331   Gene: ENSMUSG00000028914   Transcript: ENSMUST00000153094
Sequence length 215
Comment pep:known chromosome:GRCm38:4:141793710:141805442:1 gene:ENSMUSG00000028914 transcript:ENSMUST00000153094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQAGSGSRRDQARQLVTD
LETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLTA
KEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVPG
KIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLG
Download sequence
Identical sequences A2AS92
ENSMUSP00000121331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]