SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000121648 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000121648
Domain Number 1 Region: 95-265
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-24
Family Nuclear receptor ligand-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000121648   Gene: ENSMUSG00000002393   Transcript: ENSMUST00000137058
Sequence length 270
Comment pep:putative chromosome:GRCm38:8:71375819:71381177:-1 gene:ENSMUSG00000002393 transcript:ENSMUST00000137058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRRHLPGRPATRSRATRSVRGCRWTAWCAGTSPVESITACSPARAARVSSSAASAAISAT
PAGQGSPTGISQGFAGTSVGTLACVSRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAV
QRGRIPHALPGPAACSPPGATGVEPFTGPPVSELIAQLLRAEPYPAAGRFGGGGAVLGID
NVCELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSELFVLNAAQAALPLHTAPLL
AAAGLHAAPMAAERAVAFMDQVRAFQEQVD
Download sequence
Identical sequences F6Q454
ENSMUSP00000121648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]