SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122543 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122543
Domain Number 1 Region: 96-262
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0059
Further Details:      
 
Domain Number 2 Region: 242-357
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.31e-22
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 482-543
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 4 Region: 563-595,629-717
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000445
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122543   Gene: ENSMUSG00000042303   Transcript: ENSMUST00000139517
Sequence length 750
Comment pep:known chromosome:GRCm38:15:80977765:81012289:1 gene:ENSMUSG00000042303 transcript:ENSMUST00000139517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNHTPSASGPFSALTPSIWPQEILAKYSQKEESSEQPELCYDEFGFRVDKEGSEPGCS
QMTGSPLVEDPPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMR
PQLWMRLSGALQKKKNSELSYREIIKNSSNDETIAAKQIEKDLLRTMPSNACFANVNSIG
VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTT
LLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLLLRIWDL
FFYEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQMDDAELLLGEAMRLAGS
LTDVAVETQRRKHLAYLIADQGQTLGTGTTTNLSQVVRRRTQRRKSGITSLLFGEDDLEA
LKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACLRS
HRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREV
ERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICV
GLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELP
ARREEEKQPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences Q8VCZ6
NP_598852.3.92730 ENSMUSP00000122543 10090.ENSMUSP00000122543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]