SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122939 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122939
Domain Number 1 Region: 17-126
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.22e-25
Family Carbon-carbon bond hydrolase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122939   Gene: ENSMUSG00000032540   Transcript: ENSMUST00000154161
Sequence length 127
Comment pep:putative chromosome:GRCm38:9:122363653:122368261:1 gene:ENSMUSG00000032540 transcript:ENSMUST00000154161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCVPCTYKKEPVRISNGNRIWTLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTD
RPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAA
YSLKYPS
Download sequence
Identical sequences D3Z7K3
ENSMUSP00000122939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]