SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123252 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123252
Domain Number 1 Region: 190-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 77-124
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 153-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000373
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000123252
Domain Number - Region: 121-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00716
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123252   Gene: ENSMUSG00000092544   Transcript: ENSMUST00000149782
Sequence length 255
Comment pep:novel chromosome:GRCm38:8:69742862:69774886:-1 gene:ENSMUSG00000092544 transcript:ENSMUST00000149782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLETCRNLAAIGYIWEEQNVEDDCKNFGRIQRHVISDSEYLLDEQEGYGNKPYDSSSLTS
IQGHMGAHTVNGPCECEASVSFEDVAVHFTQDEWALLDSSQKSLYRDVMLEICRSLATIG
THQEAHSGKTPYQYKECGKNSVCAHGGSPTMGKFYECNICGKALSSSTALQRHELIHTER
FYECTYCGKAFRYPKYLRLHERIHTGEKPYECKQCGKAFRFPGALPLHEKIHTGEKPYKC
KQCGKAFRFPGSLPL
Download sequence
Identical sequences E9PUR3
ENSMUSP00000123252 ENSMUSP00000122850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]