SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123848 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123848
Domain Number 1 Region: 158-487
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.25e-63
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000215
Further Details:      
 
Domain Number 2 Region: 489-621
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.95e-32
Family Ricin B-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123848   Gene: ENSMUSG00000037280   Transcript: ENSMUST00000159715
Sequence length 622
Comment pep:known chromosome:GRCm38:15:100691813:100729376:-1 gene:ENSMUSG00000037280 transcript:ENSMUST00000159715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRRRHMSLRLAMLGSVFMLFLFIRQKDVSNQEQAMEKPWLKSLAGQKDQVLDFMLGA
VNNIRDVMPKLQIRAPEPPQTLVSTNHSCLPGFYTPAELKPFWDRPPQDPNSPGADGKAF
QKKEWTNLETKEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLPTTS
VIIVFHNEAWSTLLRTVYSVLHTSPAILLKEIILVDDASTDEHLKERLEQYVQQLQIVRV
VRQRERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTAVVSPDIVT
IDLNTFQFSRPVQRGKAHSRGNFDWSLTFGWEMLPEHEKQRRKDETYPIKSPTFAGGLFS
ISKAYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
TSVIARNQVRLAEVWMDDYKKIFYRRNLQAAKMVQENNFGDISERLRLREQLRCHNFSWY
LHNVYPEMFVPDLNPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYVCHNLGGNQYFEYTS
QRDLRHNIGKQLCLHASGSTLGLRSCQFVGKNSRVPKDEEWELTQDQLIRNSGSGTCLTS
QDKKPAMAPCNPRDPYQLWLFV
Download sequence
Identical sequences Q8C7U7
ENSMUSP00000056705 ENSMUSP00000056705 ENSMUSP00000123848 ENSMUSP00000124793 10090.ENSMUSP00000056705 ENSMUSP00000056705 NP_001155239.1.92730 NP_001155240.1.92730 NP_766039.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]