SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123875 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123875
Domain Number 1 Region: 250-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 2 Region: 428-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000271
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 376-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 313-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 5 Region: 531-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000809
Family Laminin-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000123875
Domain Number - Region: 478-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000162
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 930-1128
Classification Level Classification E-value
Superfamily Tropomyosin 0.00167
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 79-182
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00357
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123875   Gene: ENSMUSG00000026639   Transcript: ENSMUST00000159955
Sequence length 1168
Comment pep:known chromosome:GRCm38:1:193302243:193343875:1 gene:ENSMUSG00000026639 transcript:ENSMUST00000159955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAFFLLWLALPGFLCAQQACSRGACYPPVGDLLIGRTQLLRASSTCGLTKPETYCTQYG
QWQMKCCKCDSRLPRNYNSHRVENVASSSGPMRWWQSQNDVSPVSLQLDLDKRMQLQDIM
MDFKGLTPAGMLIERSSDFGKTWRVYQYLATDCASTFPQVHQGQPKNWQDVRCRPLSQRP
NGHLTGGKVQLNLMDLASAIPASQSKKIQELGDITNLRVNFTKLAPVPQRGSYPPSAYFA
VSQLRLQGSCFCHGHADRCAPNPGGSTTAVQVNNVCVCQHNTAGPNCDRCAPFYNNRPWR
PAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGTNGGVCDNCRDHTEGKNCERCQLHYF
RNRRPSAPIHETCIPCECDPDGAVQGAPCDRLTGQCVCKEYVQGERCDLCKPGFTGLTFA
NPKGCHACDCSILGARKDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKLASGLGCEPCAC
DPRNSLSSQCNQFTGQCPCREGFGGLTCSSAAIRQCPDQTYGHVATGCRACDCDFRGTEG
PGCDKASGRCLCRPGFTGPRCDQCQRGHCDRYPVCVACHSCFQAYDTDLQEQARRLHSLR
NATEGLWTGTGLEDHGLASRLLDAKSKIEQIRQILEGTSVTEQDVAQVANGILSIRRTLQ
GLPLDLPLEEEMESFSGDLGNLDRSFSRLLLMYRSKKEQFEKLSSEDPSGAFRMLTMAYE
QSSRAAQQVSDSSSLLSQLRDSRREAEGLERQAGGGGTGGAQLMALRLEMASLPDLTPTI
NKLCGRSRQTACTPGDCPGELCPQDNGTACGSHCRGALPRAKGAFHMAGRVAEQLRNFNT
QLQQTRQMIRAAEEAASRVQADAQRLETQVSTSRLLMEEDVQRTRLLIQQVRGFLTDPDT
DAATIQQVSEAVLALWLPTDSATVLRKMKEIQAIAARLPNVDSVLSQTKQDIARARRLQA
EAEQARSRAHAVEGQVDDVVGNLRQGTVALQEAQDTMQGTGRSLRLIQERVGEVQQVLVP
AERLVKGMKEQMSGFWARMKELRRQAQEEQAQAMQARQLAEGASQQAMNAQEGFKRLKQK
YTELKDRLGQSPVLGEQGNRILSIKMEAEELFGETMEMMDKMKDMESELLRGSQAIMLRS
ADLSGLEKRVEQIRSYINGRVLYYATCK
Download sequence
Identical sequences Q61087
ENSMUSP00000016315 ENSMUSP00000016315 ENSMUSP00000123875 ENSMUSP00000016315 NP_001264857.1.92730 NP_032510.2.92730 XP_006497295.1.92730 XP_006497296.1.92730 10090.ENSMUSP00000016315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]