SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124075 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124075
Domain Number 1 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.48e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 856-913
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 635-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 105-161
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-24
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 5 Region: 800-857
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-22
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 7 Region: 744-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-21
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 9 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.56e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 10 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 898-950
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 12 Region: 339-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000226
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 13 Region: 539-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000341
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 14 Region: 280-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000143
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000124075
Domain Number - Region: 39-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00248
Family KRAB domain (Kruppel-associated box) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124075   Gene: ENSMUSG00000063108   Transcript: ENSMUST00000159569
Sequence length 959
Comment pep:known chromosome:GRCm38:9:20432972:20460160:-1 gene:ENSMUSG00000063108 transcript:ENSMUST00000159569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTSLSCESLLSGDQNCSQGEETEGESMLADCLKNCNKDEAVDFSEEEWTTKAPTQNSK
PGAVAVEEHTSLAAVELEKQLQTKDLAPEQDFLTRHTFMETQQVDAVTFEDVAVDFTQEE
WTSLDPVQRNLYRDVMLENYQNLATVGGQMFKPSLISWLEKKVELTVIEQGILQEWEMHL
KTKRTALQQDRFWSDMSNGMQLGREHSGGEPGDPVQVGAVFSEDSCPQTHSSTSNTGNTF
ACNLDGKDFQPLLKETSTEENIVQLNQCVKPLIFTPDVSQKKCTPEKSVECSDCGETFVN
QLELQTHSSSHREKNIHKSEECGQASTHPISHGGHVIPTEKKYYECKKCEKFFTHPVYLN
IHMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHMR
SHTGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTG
EKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPF
RCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKE
CGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKT
FTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISF
AQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLT
IHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLK
IHTGEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTG
EKPYVCQYCGKAFTEHSGLNKHLRKHTGEKPYEYKECGENFTTSADANEHETPHWGENL
Download sequence
Identical sequences G3XA08
ENSMUSP00000124075 ENSMUSP00000124075 NP_035883.2.92730 XP_011240758.1.92730 XP_017168775.1.92730 ENSMUSP00000123960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]