SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124909 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124909
Domain Number 1 Region: 899-1080
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.1e-40
Family Ypt/Rab-GAP domain of gyp1p 0.005
Further Details:      
 
Domain Number 2 Region: 1055-1176
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.6e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 191-221,319-448
Classification Level Classification E-value
Superfamily PH domain-like 9.23e-30
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 26-184
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-23
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000124909
Domain Number - Region: 443-504
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0445
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124909   Gene: ENSMUSG00000033083   Transcript: ENSMUST00000162617
Sequence length 1306
Comment pep:novel chromosome:GRCm38:14:101443723:101608486:-1 gene:ENSMUSG00000033083 transcript:ENSMUST00000162617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPSCIQDEPFPHPLEPEPSAPAQPGATKPGDKRFRLWYVGGSCLDRRTTLPMLPWLMA
EIRRRSQKPDAGGCGAPAAREVILVLSAPFLRCVPAPGAGVGGGAGSGAVQPNTGVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPNQVPDVISSIRQLSKA
AMKEDSKPSKDNEDAFYNSQKFEVLYCGRVIVTHKKAPSSLIDDCKDKFSLHEQQRLKLQ
GERGGDPGDEMGVLEVESPVSPDDSLPEKADGTVNSPRALPSLASLPALASQPALASSRV
CFPERILEDCGFDEQQEFRSRCSSVTGVMQKKVHENNQKTQPRRRHASAPSHVQPSDSEK
NRTMLFQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQY
ICYVFQCANESLVDEVMLTLKQAFSTAAALQSAKTQIKLCETCPMHSLHKLCERIEGLYP
PRAKLVIQRHLSSLTDNEQADIFERVQKMKPISDQEENELVILHLRQLCEAKQRTHVHIG
EGPAIISNSTIPENVTSGGRFKLDVLKNKAKRSLTSSLENIFSRGANRMRGRLGSMDSFE
RANSLASEKDFSPGDSPPGTPPASPLSSAWHAFPEEDSDSPQFRRRAHTFSHPPSSSRRK
LNLQDGKAHGLRSPLLRQSSSEQCSIVPSARRMYKESNSSCSLPSLHTSFSAPSFTAPSF
LKSFYQNSGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLNAGGTPVTPRRVSWR
QRIFLRVASPVNKSPSAMQQQKDGLDRTELLPLSPLSPTMEEEPLIIFLSGDEDTEKVEE
KKKSKELKSLWKKAIHQQILLLRMEKENQKLEARRDELQSRKVKLDYEEVGTCQKEILIA
WDKKLLNCRTKIRCDMEDIHTSLKEGVPKSRRGEIWQFLALQYRLRHRLPNKHQPPDTSY
KELLKQLTAQQHAILVDLGRTFPTHPYFSVQLGAGQLSLFNLLKAYSLLDKEVGYCQGIS
FVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRELYNH
LEENEISPSLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSSQEALIM
ECENFENIVEFLKSTLPDMNTTEMEKIITQVFEMDISKQLHAYEVEYHVLQDELLESSYA
CEDNESLEKLERANNQLKRQNMDLLEKLQVAHAKIQALESNLETLLTRETKMKALIRTLE
QDKMAYQKTVEQIRKLLPADALANCELLLKDLTHPTNDKAKAGNKP
Download sequence
Identical sequences E0CX53
ENSMUSP00000124909 ENSMUSP00000124734 XP_006518823.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]