SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125112 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125112
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.7e-82
Family Carbonic anhydrase 0.000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125112   Gene: ENSMUSG00000031883   Transcript: ENSMUST00000159416
Sequence length 208
Comment pep:putative chromosome:GRCm38:8:104534700:104550343:1 gene:ENSMUSG00000031883 transcript:ENSMUST00000159416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSITNNGHSVQVDFNDSDDRTVVSGGPLEGPYRLKQLHFHWGKKRDMGSEHTVDGKSF
PSELHLVHWNAKKYSTFGEAAAAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKDTKA
QFSCFNPKCLLPTSRHYWTYPGSLTTPPLSESVTWIVLREPIRISERQMEKFRSLLFTSE
DDERIHMVDNFRPPQPLKGRVVKASFQA
Download sequence
Identical sequences G3XA26
NP_001288093.1.92730 NP_001288094.1.92730 XP_006530680.1.92730 XP_006530681.1.92730 ENSMUSP00000125112 ENSMUSP00000125404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]