SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126540 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126540
Domain Number 1 Region: 211-312
Classification Level Classification E-value
Superfamily HMG-box 1.01e-20
Family HMG-box 0.0000878
Further Details:      
 
Domain Number 2 Region: 93-173
Classification Level Classification E-value
Superfamily HMG-box 3.27e-20
Family HMG-box 0.0000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126540   Gene: ENSMUSG00000074502   Transcript: ENSMUST00000169398
Sequence length 394
Comment pep:known chromosome:GRCm38:9:18404420:18411325:1 gene:ENSMUSG00000074502 transcript:ENSMUST00000169398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLDNQGLWSEKDILKLLECMEHNIPSDDSREFKKSQADLNWSKVAFGLFSGEMCKQKW
MEISYNLRKFRTLTELVQEAKFSFTKKTHKNKILTEHPDRPKRPLTAYLRFYKEQRAKYC
QMYPKYSNAQLTKILAEKYRQLPAEIKQRYIMDFKKEKEDFQKKMRQFKKRHPVSGHPKK
SVVPQSHPTKVPTKSQGDIKNVKSLVKTESPRTVSSDMKFQGEPRKPPMNAYHKFHQESW
SSPELRHLSFRKRWVEISRRWHQVPENEKEHYSNQVKRLQKQYRVKLDLWLKRLSPEEYA
AYKEAKATCGKRKNMSMSGGRSSKFGRTEQSSSEKGLQIKPGEVEELLDPGTDSSGTIQG
HHDGAQSSRQDFTDDSEEDDSSTSSDSSSTDEDD
Download sequence
Identical sequences Q3USZ2
ENSMUSP00000096572 ENSMUSP00000126540 ENSMUSP00000129611 10090.ENSMUSP00000096572 ENSMUSP00000096572 NP_001028965.1.92730 XP_011240880.1.92730 ENSMUSP00000096572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]