SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126788 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126788
Domain Number 1 Region: 205-445
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-70
Family Nuclear receptor ligand-binding domain 0.00000000048
Further Details:      
 
Domain Number 2 Region: 76-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-26
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126788   Gene: ENSMUSG00000060601   Transcript: ENSMUST00000167197
Sequence length 446
Comment pep:known chromosome:GRCm38:7:44549652:44553923:-1 gene:ENSMUSG00000060601 transcript:ENSMUST00000167197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPTSSLDTPVPGNGSPQPSTSATSPTIKEEGQETDPPPGSEGSSSAYIVVILEPEDEP
ERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSG
TCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKRIQKQQQQQPPPPSEPAASSS
GRPAASPGTSEASSQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLG
ADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLE
TARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIA
INIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVH
SEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences Q60644
ENSMUSP00000073188 ENSMUSP00000073188 ENSMUSP00000073188 ENSMUSP00000103545 ENSMUSP00000126788 NP_001272446.1.92730 NP_033499.1.92730 XP_006540867.1.92730 10090.ENSMUSP00000103545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]