SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127045 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127045
Domain Number 1 Region: 50-109
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-24
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 478-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 286-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-18
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 7 Region: 224-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000122
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 534-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000129
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127045   Gene: ENSMUSG00000059475   Transcript: ENSMUST00000169558
Sequence length 564
Comment pep:putative chromosome:GRCm38:9:20468708:20492742:-1 gene:ENSMUSG00000059475 transcript:ENSMUST00000169558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLFPLPKCWDSRMAAPASSHGPSEDSGCLQERKIAAEMMLVDCLTDDQELVSFEDVIV
DFTQEEWSSLNPDQRNLYRDVMLENYQNLATVGYQLIKPSLISWLEQEEFSKGQKIVFPE
WKLQLETKCSAFQQEFLRGNISSRMQMQTGINRGRELCDGTQYGDFFSELSPLRTDMKTQ
PAQDNYGCSQYRKDFLMLQRKNCAGEKLSEFSQSEETGMTPVKEKIDTQEKGFECSDCGK
SFMSQSHLQTHQRTHSGDKLYEWNECGRSFINSRLAVLIETLNAKKPHRCKECGKGYRYP
AYLNIHMRTHTGEKPYECKECGKAFNYSNSFQIHGRTHTGEKPYVCSQCGKAFTQHSGLS
IHVRSHTGDKPYGCKECGKAFLTSSRLIQHIRTHTGEKPFVCVKCGKAFAISSNLNGHLK
LHAEEKTCECKICGKAFGYLSCLNNHMRTHNAKKSYTCKECGKAFNYSTHLKIHMRIHTG
EKPYECKQCGKAFSHSTSFQIHERTHTGEKPYECKECGKAFICPSSFRIHEISHTHTEEK
PYKCQQCGKAYSHPRSLRRHERIH
Download sequence
Identical sequences G5E8Z9
ENSMUSP00000127045 ENSMUSP00000127045 ENSMUSP00000130309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]