SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127976 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127976
Domain Number 1 Region: 12-244
Classification Level Classification E-value
Superfamily DNase I-like 6.54e-40
Family DNase I-like 0.000000168
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000127976
Domain Number - Region: 235-281
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0876
Family Probable GTPase Der, C-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127976   Gene: ENSMUSG00000090353   Transcript: ENSMUST00000164042
Sequence length 371
Comment pep:known chromosome:GRCm38:2:126215100:126216212:1 gene:ENSMUSG00000090353 transcript:ENSMUST00000164042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTLTTKIKGSNNYFSLISLNINGLNSPIKRHRLSDWLHKQEPAFCCLQETHLREKDRHY
LRVKGWKIIFQANGLKKQAGVAILISNKINFQPKVIKKDKEGHFVLIKVKILQEELSILN
IYAPNSRAATFIPDTLVKLKAHIAPHTIIVGDFNTPLSLMDRSLKQKLNRDTVKLTEVMK
QMDLTDIYRTFYPKTKGYTFFSAPHGTFSKIDHIIGHKTGLNRYKNIEIVPCILSDHHGL
RLIFNNNINNGKPTFTWKLNNTLLNDTLVKEGIKKEIKDFLEFNENEAKTYPNLWDTMKA
FLRGKLIALSASKKKLERAHSSSLTTHLNALEKKEENSPKRSRWQEIIKLKGKINQVETR
SIIQTVNQRRS
Download sequence
Identical sequences F6U8B9
ENSMUSP00000127976 ENSMUSP00000127976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]