SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128318 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128318
Domain Number 1 Region: 190-298
Classification Level Classification E-value
Superfamily Immunoglobulin 3e-16
Family I set domains 0.038
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000565
Family Growth factor receptor domain 0.0021
Further Details:      
 
Domain Number 3 Region: 110-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000115
Family Ovomucoid domain III-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128318   Gene: ENSMUSG00000036256   Transcript: ENSMUST00000163898
Sequence length 313
Comment pep:known chromosome:GRCm38:5:77349240:77408045:-1 gene:ENSMUSG00000036256 transcript:ENSMUST00000163898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMERPPRALLLGAAGLLLLLLPLSSSSSSDACGPCVPASCPALPRLGCPLGETRDACGCC
PVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVC
GSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGSLIWDTQPAQRSHNPQVENRC
FRDKHSREQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELL
PGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDAL
HEIPLKKGEGAQL
Download sequence
Identical sequences E9Q5D9
NP_001152990.1.92730 ENSMUSP00000128318 ENSMUSP00000128318 ENSMUSP00000128318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]