SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128381 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128381
Domain Number 1 Region: 89-214,319-417,532-688
Classification Level Classification E-value
Superfamily L domain-like 3.62e-60
Family Ngr ectodomain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 1147-1336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.49e-44
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 759-896
Classification Level Classification E-value
Superfamily L domain-like 1.5e-33
Family Ngr ectodomain-like 0.0085
Further Details:      
 
Domain Number 4 Region: 1006-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 5 Region: 924-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 6 Region: 1083-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000552
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1044-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000955
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 8 Region: 965-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128381
Domain Number - Region: 1332-1372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000145
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1377-1411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000359
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128381   Gene: ENSMUSG00000025020   Transcript: ENSMUST00000166496
Sequence length 1458
Comment pep:putative chromosome:GRCm38:19:41600451:41743492:-1 gene:ENSMUSG00000025020 transcript:ENSMUST00000166496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTPQRGSSSGLSRPELWLLLWAAAWRLGATACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LQVLPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQLDKNRISCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKGEFSCSGQGEAAGAPACTLSSGSCPAMCSCSSGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETTGARCASPRRLANKRIGQI
KSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEASVVECSSLKLSKIPERIPQ
STTELRLNNNEISILEATGLFKKLSHLKKINLSNNKVSEIEDGTFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTL
QALSTLNLLANPFNCNCHLSWLGDWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEVGCLPRPQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLH
GNDVSTLQEGIFADVTSLSHLAIGANPLYCDCRLRWLSSWVKTGYKEPGIARCAGPPEME
GKLLLTTPAKKFECQGPPSLAVQAKCDPCLSSPCQNQGTCHNDPLEVYRCTCPSGYKGRH
CEVSLDGCSSNPCGNGGTCHAQEGEDAGFTCSCPSGFEGPTCGVDTDDCVKHACVNGGVC
VDGVGNYTCQCPLQYTGRACEQLVDFCSPDMNPCQHEAQCVGTPDGPRCECMLGYTGDNC
SENQDDCKDHKCQNGAQCVDEVNSYACLCVEGYSGQLCEIPPAPRSSCEGTECQNGANCV
DQGSRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGIL
LYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVTFDQMVNLSID
GGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNEL
QDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPVDGPCHG
HKCVHGKCVPLDALAYSCQCQDGYSGALCNQSPSAGGTLSGTFTGSRGAMPSARPHARCR
GWNAGARARARAAARACG
Download sequence
Identical sequences E9QAW9
ENSMUSP00000128381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]