SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129071 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129071
Domain Number 1 Region: 112-126,229-497
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-68
Family Nuclear receptor ligand-binding domain 0.000000000657
Further Details:      
 
Domain Number 2 Region: 44-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-30
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129071   Gene: ENSMUSG00000026398   Transcript: ENSMUST00000168126
Sequence length 499
Comment pep:known chromosome:GRCm38:1:136843584:136953630:-1 gene:ENSMUSG00000026398 transcript:ENSMUST00000168126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRADR
MRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTSAIQNIHSASKG
LPLSHVALPPTDYDRSPFVTSPISMTMPPHSSLHGYQPYGHFPSRAIKSEYPDPYSSSPE
SMMGYSYMDGYQTNSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAF
GLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGT
IFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVK
NLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHV
NGDVPYNNLLIEMLHAKRA
Download sequence
Identical sequences Q1WLP7
NP_001153241.1.92730 XP_006529685.1.92730 ENSMUSP00000129071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]