SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129412 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129412
Domain Number 1 Region: 187-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.68e-55
Family Voltage-gated potassium channels 0.0009
Further Details:      
 
Domain Number 2 Region: 15-128
Classification Level Classification E-value
Superfamily POZ domain 6.28e-33
Family Tetramerization domain of potassium channels 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129412   Gene: ENSMUSG00000043673   Transcript: ENSMUST00000164495
Sequence length 491
Comment pep:known chromosome:GRCm38:12:11090202:11150842:-1 gene:ENSMUSG00000043673 transcript:ENSMUST00000164495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPFLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSSR
YQERKEESHDKDWDQKSNDVSTDSSFEESSLFEKELEKFDELRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAIR
LVAAPSQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDEHKSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKIIASTCIICGILVVALPITIIFNKFSKYYQKQKDME
VDQCSEDPPEKCHELPYFNIRDVYAQQVHAFITSLSSIGIVVSDPDSTDASSVEDNEDAY
NTASLENCTGK
Download sequence
Identical sequences Q8BQZ8
ENSMUSP00000060706 10090.ENSMUSP00000060706 ENSMUSP00000060706 ENSMUSP00000129412 NP_001162036.1.92730 NP_775593.1.92730 XP_006515143.1.92730 XP_011242164.1.92730 XP_011242165.1.92730 XP_011242166.1.92730 XP_011242167.1.92730 XP_011242168.1.92730 ENSMUSP00000060706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]