SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129626 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129626
Domain Number 1 Region: 135-246
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 7.59e-30
Family Troponin T 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129626   Gene: ENSMUSG00000064179   Transcript: ENSMUST00000163710
Sequence length 250
Comment pep:known chromosome:GRCm38:7:4504663:4515959:-1 gene:ENSMUSG00000064179 transcript:ENSMUST00000163710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTEEQEYEEEQAEDEEAVEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRME
KDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEK
MRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKP
LNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGA
GKGRVGGRWK
Download sequence
Identical sequences NP_001264191.1.100692 NP_001264191.1.4139 NP_001264833.1.92730 XP_021074392.1.100879 ENSMUSP00000129626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]