SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130477 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130477
Domain Number 1 Region: 375-428
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000919
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 2 Region: 16-194
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000144
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130477   Gene: ENSMUSG00000041263   Transcript: ENSMUST00000166687
Sequence length 431
Comment pep:known chromosome:GRCm38:3:89083981:89090031:-1 gene:ENSMUSG00000041263 transcript:ENSMUST00000166687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAQSGTGQLQEQKKGLLIAVSASVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLT
TLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSCTHSMGSLYSQVSRLAPL
SSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGSCPSLATELLL
LLQPLSVLTFHLDLLFEHHHHLPVGLQQAPAPSCPPPALQQTMQAVLHWGERLAQSLRGT
SGESTTDSSTPSARPPAGSWWDQLTQASRVYASGGTEGFPLLRWGPRRHGTTAEAAQEAP
PPTEQTTPGRSVWLGRLFGVPGCPSETESGAFKSRRPSSWLPPTVSVLALVKRGTPPETP
PEALVSSPGSVVQADRAVRALCDHTAAGPDQLSFQRGELLRVIATVDEDWLRCGRDGVEG
LVPVGYTSLVL
Download sequence
Identical sequences Q3TDG5
ENSMUSP00000130477 NP_001077277.1.92730 XP_006502197.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]