SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131545 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131545
Domain Number 1 Region: 18-257
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.89e-70
Family BAR domain 0.0006
Further Details:      
 
Domain Number 2 Region: 273-286,321-378
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000452
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131545   Gene: ENSMUSG00000026860   Transcript: ENSMUST00000163668
Sequence length 379
Comment pep:known chromosome:GRCm38:2:30344811:30359289:-1 gene:ENSMUSG00000026860 transcript:ENSMUST00000163668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQT
EVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPSTPYGKTLIKVSE
AEKRLGAAERDFIHTASLSFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATLWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQT
TYYAQCYRHMLDLQKQLGSSQGAIFPGTFVGTTEPASPPLSSTSPTTTAATMPVVPTGAV
LAPPEEAALCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLI
GERGNKKGKVPVTYLELLS
Download sequence
Identical sequences XP_006498002.1.92730 ENSMUSP00000131545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]