SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132131 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132131
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-39
Family SCAN domain 0.0000496
Further Details:      
 
Domain Number 2 Region: 231-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000144
Family KRAB domain (Kruppel-associated box) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132131   Gene: ENSMUSG00000025602   Transcript: ENSMUST00000168832
Sequence length 277
Comment pep:putative chromosome:GRCm38:9:40192329:40213189:1 gene:ENSMUSG00000025602 transcript:ENSMUST00000168832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFRRFRYQEASSP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVQGQEVLSEETLHLGLEPESSSEQQDPTQTLTTEQPHEEALR
SPDLGTQEQETLQHDEEHLPLPECEVPVSQDVDLPTEQGSGHPEMVALLTALSQGLVTFK
DVALCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSL
Download sequence
Identical sequences E9Q2D3
ENSMUSP00000132131 XP_017169190.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]