SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132616 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132616
Domain Number 1 Region: 383-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000446
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 2 Region: 319-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 3 Region: 506-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 469-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132616   Gene: ENSMUSG00000002900   Transcript: ENSMUST00000164919
Sequence length 564
Comment pep:known chromosome:GRCm38:12:31265400:31329575:1 gene:ENSMUSG00000002900 transcript:ENSMUST00000164919 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEGPLSSLPTFAFSPRYLSRKEDPKKRQAACLLRPPSRAASPRLRGLDMGLLQVFAFGVL
ALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQE
DKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFH
FTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDS
RYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRM
EIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELC
MDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGR
NCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHV
EGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQ
CLPQHWGLSNDLDGCRPCCSREGD
Download sequence
Identical sequences ENSMUSP00000132616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]