SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132778 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132778
Domain Number 1 Region: 773-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000156
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 2 Region: 335-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 3 Region: 821-869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 867-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family Laminin-type module 0.0041
Further Details:      
 
Domain Number 5 Region: 271-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000858
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 6 Region: 976-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.003
Further Details:      
 
Domain Number 7 Region: 928-978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.084
Further Details:      
 
Domain Number 8 Region: 458-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 510-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1084-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 421-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 12 Region: 1132-1179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1028-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000132778
Domain Number - Region: 1574-1777
Classification Level Classification E-value
Superfamily Tropomyosin 0.000281
Family Tropomyosin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132778   Gene: ENSMUSG00000002900   Transcript: ENSMUST00000169088
Sequence length 1786
Comment pep:putative chromosome:GRCm38:12:31265234:31329493:1 gene:ENSMUSG00000002900 transcript:ENSMUST00000169088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLQVFAFGVLALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGG
VCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVG
LIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCY
CKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQC
NEVESGYYFTTLDHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFF
IDNIPYSMEYEILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPG
SRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGG
SGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQC
HCFQGIYARQCDRCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GFFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDA
LRQDCRKCVCNYLGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTG
CGPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKF
LEKAKALKISGVIGPYRETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDV
TEKMAQVEVKLTDTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDS
ITKYFQMSLEAEKRVNASTTDPNSTVEQSALTRDRVEDLMLERESPFKEQQEEQARLLDE
LAGKLQSLDLSAVAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSA
WQKAMDFDRDVLSALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDL
RNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVI
LQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVK
QNADDVKKTLDGELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLL
EDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL
Download sequence
Identical sequences P02469
ENSMUSP00000132778 XP_006515055.2.92730 XP_006515056.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]