SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133044 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133044
Domain Number 1 Region: 206-463
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.65e-83
Family Nuclear receptor ligand-binding domain 0.000000000841
Further Details:      
 
Domain Number 2 Region: 137-218
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133044   Gene: ENSMUSG00000015846   Transcript: ENSMUST00000166775
Sequence length 467
Comment pep:known chromosome:GRCm38:2:27677262:27761417:1 gene:ENSMUSG00000015846 transcript:ENSMUST00000166775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNG
VLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT
Download sequence
Identical sequences A2AJP1 P28700
ENSMUSP00000097822 NP_035435.1.92730 ENSMUSP00000076491 ENSMUSP00000133044 ENSMUSP00000076491 10090.ENSMUSP00000076491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]