SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133230 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133230
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily Serpins 1.83e-19
Family Serpins 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133230   Gene: ENSMUSG00000000753   Transcript: ENSMUST00000167281
Sequence length 125
Comment pep:known chromosome:GRCm38:11:75410221:75415730:-1 gene:ENSMUSG00000000753 transcript:ENSMUST00000167281 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEKNLKSASRIVFERKLRVKSSF
VAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFK
VGNQV
Download sequence
Identical sequences F6S1M4
ENSMUSP00000133230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]